PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D10G0550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 352aa    MW: 38868.7 Da    PI: 6.5938
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D10G0550genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.65.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+++++  g+ R++k+c++rw +yl
      Gh_D10G0550 14 RGLWSPEEDEKLINYITTYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding48.42.1e-1567109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg+++++E  l+++++  lG++ W+ Ia++++ gRt++++k++w+
      Gh_D10G0550  67 RGSFSPQEAALIIELHSILGNR-WAQIAKHLP-GRTDNEVKNFWN 109
                      899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.315961IPR017930Myb domain
SuperFamilySSF466891.95E-2911108IPR009057Homeodomain-like
SMARTSM007172.0E-131363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001674.57E-121761No hitNo description
PROSITE profilePS5129425.20962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2565117IPR009057Homeodomain-like
SMARTSM007171.5E-1566114IPR001005SANT/Myb domain
PfamPF002493.2E-1467110IPR001005SANT/Myb domain
CDDcd001672.62E-1169109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLINYIT TYGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SPQEAALIIE LHSILGNRWA QIAKHLPGRT DNEVKNFWNS SIKKKLISHD  120
HVPALASFAD VHSSNHTEEA GFISLNANPN LILTAQQDQL YLSPTAPVLQ SFGHHADLVH  180
HHFPLTPMLP PPPPPSNTAS FDPAWTLPFG PQHDQDDDQH HQVQVFNNEA AQNFVSDKLM  240
NPPFDNPLMG PPTVPKLCEI LEGNMVCNIP QTSSVSLENN IDPLVSRLSS CFPPIPAGSN  300
YAHDMQVGAS QMEYIDNIIT SIPSSSSSSS LSALSSGQYL TNPNLPSSSW DP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31141167108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5183200.0AY518320.1 Gossypium hirsutum MYB9 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012455507.10.0PREDICTED: transcription factor MYB46-like isoform X1
RefseqXP_012455508.10.0PREDICTED: transcription factor MYB46-like isoform X1
TrEMBLQ5SF860.0Q5SF86_G
STRINGPOPTR_0001s20370.11e-127(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.22e-81myb domain protein 26